Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACAA2 Peptide - middle region

ACAA2 Peptide - middle region

Product Specifications

Product Name Alternative

AI255831, AI265397, D18Ertd240e, 0610011L04Rik

UniProt

Q8BWT1

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_803421.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FNEEMAPIEVKTKKGKQTMQVDEHARPQTTLEQLQKLPSVFKKDGTVTAG

More Discoveries

Explore Other Products

Browse additional items from our catalog

Protor 1 (PRR5) (NM_015366) Human Tagged ORF Clone
RG217823 10 µg

Protor 1 (PRR5) (NM_015366) Human Tagged ORF Clone

Sign In for Pricing
View Details
ARNT2 Rabbit Polyclonal Antibody (PE-Cy5)
orb973473 100 µL

ARNT2 Rabbit Polyclonal Antibody (PE-Cy5)

Sign In for Pricing
View Details
PTGDS Polyclonal Antibody, Biotin Conjugated
A50435-050 50 µL

PTGDS Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
Adenosine 5'-Monophosphate
295190-01 100 g

Adenosine 5'-Monophosphate

Sign In for Pricing
View Details
Adenosine 5'-Monophosphate
295190-02 250 g

Adenosine 5'-Monophosphate

Sign In for Pricing
View Details
Adenosine 5'-Monophosphate
295190-03 500 g

Adenosine 5'-Monophosphate

Sign In for Pricing
View Details