HMGB3 Peptide - middle region
HMGB3 Peptide - middle region
Product Specifications
Product Name Alternative
Hmg4, Hmg2a
UniProt
O54879
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001280552.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VRYDREMKDYGPAKGGKKKKDPNAPKRPPSGFFLFCSEFRPKIKSTNPGI
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
bs-24471R-PE 100 µL
Carbonic anhydrase 3 Polyclonal Antibody, PE Conjugated
Sign In for Pricing
View Details 
26929154 3x 1.0 µg DNA
LOC100038947 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
Sign In for Pricing
View Details GTR15118168 1 Vial
Lentiviral human SLC25A15 shRNA (UAS) - Lentiviral human SLC25A15 shRNA (UAS, iRFP) plasmid
Sign In for Pricing
View Details