HMGB3 Peptide - middle region
HMGB3 Peptide - middle region
Product Specifications
Product Name Alternative
Hmg4, Hmg2a
UniProt
O54879
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001280552.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VRYDREMKDYGPAKGGKKKKDPNAPKRPPSGFFLFCSEFRPKIKSTNPGI
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TMPY-04938-01 5 µg
CSF1R Protein, Mouse, Recombinant (His), Biotinylated
Sign In for Pricing
View Details TMPY-04938-02 10 µg
CSF1R Protein, Mouse, Recombinant (His), Biotinylated
Sign In for Pricing
View Details TMPY-04938-03 20 µg
CSF1R Protein, Mouse, Recombinant (His), Biotinylated
Sign In for Pricing
View Details TMPY-04938-04 50 µg
CSF1R Protein, Mouse, Recombinant (His), Biotinylated
Sign In for Pricing
View Details TMPY-04938-05 100 µg
CSF1R Protein, Mouse, Recombinant (His), Biotinylated
Sign In for Pricing
View Details 