Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IGF2BP3 Peptide - middle region

IGF2BP3 Peptide - middle region

Product Specifications

Product Name Alternative

IMP3, IMP-3, Koc13, mimp3, Neilsen, AA522010, AL022933, AU045931, 2610101N11Rik

UniProt

Q9CPN8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_076159.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LIPGLNLNALGLFPPTSGMPPPTSGPPSTLTPPYPQFEQSETETVHLFIP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Monoamine Oxidase A Antibody
RC-15940-01 50 μL

Recombinant Monoamine Oxidase A Antibody

Sign In for Pricing
View Details
Recombinant Monoamine Oxidase A Antibody
RC-15940-02 100 µL

Recombinant Monoamine Oxidase A Antibody

Sign In for Pricing
View Details
Recombinant Monoamine Oxidase A Antibody
RC-15940-03 1 mL

Recombinant Monoamine Oxidase A Antibody

Sign In for Pricing
View Details
C5ORF44 (TRAPPC13) (NM_001093755) Human Over-expression Lysate
LC420688 20 µg

C5ORF44 (TRAPPC13) (NM_001093755) Human Over-expression Lysate

Sign In for Pricing
View Details
GlycoLinerTM 650/670 Cell Surface Glycoprotein Labeling Kit, 500 Labelings
#30146 1 Kit

GlycoLinerTM 650/670 Cell Surface Glycoprotein Labeling Kit, 500 Labelings

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary: right
CS638172 5x 5 µm

Frozen Tissue Sections, Ovary: right

Sign In for Pricing
View Details