Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IGF2BP3 Peptide - middle region

IGF2BP3 Peptide - middle region

Product Specifications

Product Name Alternative

IMP3, IMP-3, Koc13, mimp3, Neilsen, AA522010, AL022933, AU045931, 2610101N11Rik

UniProt

Q9CPN8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_076159.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LIPGLNLNALGLFPPTSGMPPPTSGPPSTLTPPYPQFEQSETETVHLFIP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Aanat Mouse Gene Knockout Kit (CRISPR)
KN500585 1 Kit

Aanat Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
HRP Conjugated Ulex europaeus Lectin (GorseFurze) -UEA-I-
H-2201-1 1 mg

HRP Conjugated Ulex europaeus Lectin (GorseFurze) -UEA-I-

Sign In for Pricing
View Details
MCM6 (Proliferation Marker) (MCM6/2999), 0.2mg/mL
BNUB2999-100 1x 100 µL

MCM6 (Proliferation Marker) (MCM6/2999), 0.2mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS712926 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
PRMT7 (NM_019023) Human Over-expression Lysate
LC402728 20 µg

PRMT7 (NM_019023) Human Over-expression Lysate

Sign In for Pricing
View Details
Napsin A (Lung Adenocarcinoma Marker) (NAPSA/3306), CF740 conjugate, 0.1mg/mL
BNC743306-100 1x 100 µL

Napsin A (Lung Adenocarcinoma Marker) (NAPSA/3306), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details