What is the catalog number for KIF20A Peptide - middle region?

The catalog number for KIF20A Peptide - middle region is orb1997526.

What sizes are available for KIF20A Peptide - middle region?

KIF20A Peptide - middle region is available in the following size(s): 100 µg.

Is KIF20A Peptide - middle region in stock?

KIF20A Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

KIF20A Peptide - middle region

Product Specifications

Product Name Alternative

AA415432, Rab6kifl

UniProt

P97329

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001159878.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EPPSHQHKRQTLRLCEDQNGNPYVKDLNWIHVRDVEEAWKLLKVGRKNQS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

28356024 500 ng

MEN1 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing

View Details

NBP2-90515G 0.1 mL

Rabbit Monoclonal Uteroglobin/SCGB1A1 Antibody (016) [DyLight 488]

Sign In for Pricing

View Details

HA723749 100 µL

WWOX Recombinant Rabbit monoclonal Antibody

Sign In for Pricing

View Details

228406-01 250 mg

1- (2-Quinoxalinyl) -1,2,3,4-butanetetrol

Sign In for Pricing

View Details

228406-02 1 g

1- (2-Quinoxalinyl) -1,2,3,4-butanetetrol

Sign In for Pricing

View Details

228406-03 5 g

1- (2-Quinoxalinyl) -1,2,3,4-butanetetrol

Sign In for Pricing

View Details