KIF20A Peptide - middle region
KIF20A Peptide - middle region
Product Specifications
Product Name Alternative
AA415432, Rab6kifl
UniProt
P97329
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001159878.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: EPPSHQHKRQTLRLCEDQNGNPYVKDLNWIHVRDVEEAWKLLKVGRKNQS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
RD-IL1a-Hu-96Tests 96 Tests
Human Interleukin 1 Alpha (IL1a) ELISA Kit
Sign In for Pricing
View Details MBS1074443-01 0.02 mg (E-Coli)
Recombinant Theromyzon tessulatum Theromin
Sign In for Pricing
View Details MBS1074443-02 0.1 mg (E-Coli)
Recombinant Theromyzon tessulatum Theromin
Sign In for Pricing
View Details MBS1074443-03 0.02 mg (Yeast)
Recombinant Theromyzon tessulatum Theromin
Sign In for Pricing
View Details MBS1074443-04 0.1 mg (Yeast)
Recombinant Theromyzon tessulatum Theromin
Sign In for Pricing
View Details