What is the catalog number for EIF4G2 Peptide - N-terminal region?

The catalog number for EIF4G2 Peptide - N-terminal region is orb1997525.

What sizes are available for EIF4G2 Peptide - N-terminal region?

EIF4G2 Peptide - N-terminal region is available in the following size(s): 100 µg.

Is EIF4G2 Peptide - N-terminal region in stock?

EIF4G2 Peptide - N-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

EIF4G2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

P97, Nat1, DAP-5, Natm1, E130105L11Rik

UniProt

Q62448

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001035221.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GQNAQKWIPARSTRRDDNSAANNSANEKERHDAIFRKVRGILNKLTPEKF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IHUASAP3PLLY20UG 20 µg

Human ASAP3 Protein Lysate 20ug

Sign In for Pricing

View Details

BM4008APC 100 Tests

Adgre1 Rat Monoclonal Antibody [Clone ID: CI:A3-1]

Sign In for Pricing

View Details

42-823 0.1 mg

EFNB2 Antibody

Sign In for Pricing

View Details

MBS3802997-01 48 Well

Human Protein Kinase C epsilon ELISA Kit

Sign In for Pricing

View Details

MBS3802997-02 96 Well

Human Protein Kinase C epsilon ELISA Kit

Sign In for Pricing

View Details

MBS3802997-03 5x 96 Well

Human Protein Kinase C epsilon ELISA Kit

Sign In for Pricing

View Details