EIF4G2 Peptide - N-terminal region
EIF4G2 Peptide - N-terminal region
Product Specifications
Product Name Alternative
P97, Nat1, DAP-5, Natm1, E130105L11Rik
UniProt
Q62448
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001035221.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GQNAQKWIPARSTRRDDNSAANNSANEKERHDAIFRKVRGILNKLTPEKF
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR10372186 96 Well
Monkey Serine threonine kinase receptor associated protein (STRAP) ELISA kit
Sign In for Pricing
View Details 
253463-ML550 100 µL
WRN (Werner Syndrome, DKFZp686C2056, RECQ3, RECQL2, RECQL3) (MaxLight 550)
Sign In for Pricing
View Details 
214906-ML405 100 µL
I-TAC (ITAC, SCYB11, SCYB9B, Interferon-inducible T-cell alpha Chemoattractant, CXCL11) (MaxLight 405) discontinued
Sign In for Pricing
View Details