GPSM2 Peptide - middle region
GPSM2 Peptide - middle region
Product Specifications
Product Name Alternative
LGN, Pins, 6230410J09Rik
UniProt
Q8VDU0
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_083798.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: APSVSVVSPNTDEFLDLLASSQSRRLDDQRASFSNLPGLRLTKGNSPSVL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS2578837-01 20 Tests
Fluor 488 Anti-Human CD50 Antibody [CBR-IC3/1]
Sign In for Pricing
View Details MBS2578837-02 100 Tests
Fluor 488 Anti-Human CD50 Antibody [CBR-IC3/1]
Sign In for Pricing
View Details MBS2578837-03 2x 100 Tests
Fluor 488 Anti-Human CD50 Antibody [CBR-IC3/1]
Sign In for Pricing
View Details MBS2578837-04 10x 100 Tests
Fluor 488 Anti-Human CD50 Antibody [CBR-IC3/1]
Sign In for Pricing
View Details