Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NPM1 Peptide - middle region

NPM1 Peptide - middle region

Product Specifications

Product Name Alternative

B23, Npm, NO38

UniProt

Q61937

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_032748.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polycarpine hydrochloride
orb2564058-01 50 mg

Polycarpine hydrochloride

Sign In for Pricing
View Details
Polycarpine hydrochloride
orb2564058-02 10 mg

Polycarpine hydrochloride

Sign In for Pricing
View Details
2-Cyclobutyl-azepane oxalate
sc-357540A 100 mg

2-Cyclobutyl-azepane oxalate

Sign In for Pricing
View Details
OLR578 Adenovirus (Rat)
34515056 1.0 mL

OLR578 Adenovirus (Rat)

Sign In for Pricing
View Details
Recombinant Human Glucose-6-phosphatase (G6PC), partial
RPC31205-01 20 µg

Recombinant Human Glucose-6-phosphatase (G6PC), partial

Sign In for Pricing
View Details
Recombinant Human Glucose-6-phosphatase (G6PC), partial
RPC31205-02 100 µg

Recombinant Human Glucose-6-phosphatase (G6PC), partial

Sign In for Pricing
View Details