Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NPM1 Peptide - middle region

NPM1 Peptide - middle region

Product Specifications

Product Name Alternative

B23, Npm, NO38

UniProt

Q61937

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_032748.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Tail Genomic DNA Kit (purified lysis, 50 preps)
W2094 50 Preparations

Mouse Tail Genomic DNA Kit (purified lysis, 50 preps)

Sign In for Pricing
View Details
Human Docking Protein 3 (DOK3) ELISA Kit
201-12-3649 96 Tests

Human Docking Protein 3 (DOK3) ELISA Kit

Sign In for Pricing
View Details
2- (Piperidin-1-yl) pyrimidine-5-carbaldehyde
OR918977-01 100 mg

2- (Piperidin-1-yl) pyrimidine-5-carbaldehyde

Sign In for Pricing
View Details
2- (Piperidin-1-yl) pyrimidine-5-carbaldehyde
OR918977-02 250 mg

2- (Piperidin-1-yl) pyrimidine-5-carbaldehyde

Sign In for Pricing
View Details
2- (Piperidin-1-yl) pyrimidine-5-carbaldehyde
OR918977-03 1 g

2- (Piperidin-1-yl) pyrimidine-5-carbaldehyde

Sign In for Pricing
View Details
Mettl14 3'UTR GFP Stable Cell Line
TU263083 1.0 mL

Mettl14 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details