Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CITED2 Peptide - middle region

CITED2 Peptide - middle region

Product Specifications

Product Name Alternative

Mrg1, Msg2, p35srj, AI835299, ER154-like

UniProt

O35740

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_034958.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QLQKLNNQYFNHHPYPHNHYMPDLHPTAGHQMNGTNQHFRDCNPKHSGGS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

pCMV-SPORT6-Tcf4 Plasmid
PVT44361 2 µg

pCMV-SPORT6-Tcf4 Plasmid

Sign In for Pricing
View Details
ERK1/2 Antibody
MBS8510650-01 0.05 mg

ERK1/2 Antibody

Sign In for Pricing
View Details
ERK1/2 Antibody
MBS8510650-02 0.1 mg

ERK1/2 Antibody

Sign In for Pricing
View Details
ERK1/2 Antibody
MBS8510650-03 0.1 mL (AF750)

ERK1/2 Antibody

Sign In for Pricing
View Details
ERK1/2 Antibody
MBS8510650-04 0.1 mL (AF405M)

ERK1/2 Antibody

Sign In for Pricing
View Details
ERK1/2 Antibody
MBS8510650-05 0.1 mL (AF546)

ERK1/2 Antibody

Sign In for Pricing
View Details