Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

THRA Peptide - N-terminal region

THRA Peptide - N-terminal region

Product Specifications

Product Name Alternative

Rvr, Erba, Nr1a1, Thra1, Thra2, T3R[a], AW259572, T3Ralpha, c-erbA-1, c-erbAalpha, c-erbA-alpha, 6430529J03Rik

UniProt

P63058

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001300912.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NSARSPDGKRKRKNGQCPLKSSMSGYIPSYLDKDEQCVVCGDKATGYHYR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

bPiDDB
TRC-P991823-1MG 1 mg

bPiDDB

Sign In for Pricing
View Details
GMFG (NM_001301008) Human Tagged ORF Clone
RG235596 10 µg

GMFG (NM_001301008) Human Tagged ORF Clone

Sign In for Pricing
View Details
SRPR beta (SRPRB) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1D9]
TA504712BM 100 µL

SRPR beta (SRPRB) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1D9]

Sign In for Pricing
View Details
2-Phenoxyethyl-1,1,2,2-d4 Alcohol
TRC-P297901-10MG 10 mg

2-Phenoxyethyl-1,1,2,2-d4 Alcohol

Sign In for Pricing
View Details
Human DENND4C activation kit by CRISPRa
GA110869 1 Kit

Human DENND4C activation kit by CRISPRa

Sign In for Pricing
View Details
CD8A (Cytotoxic- & Suppressor T-Cell Marker) (N/A), CF405S conjugate, 0.1mg/mL
BNC041780-100 1x 100 µL

CD8A (Cytotoxic- & Suppressor T-Cell Marker) (N/A), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details