Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

THRA Peptide - N-terminal region

THRA Peptide - N-terminal region

Product Specifications

Product Name Alternative

Rvr, Erba, Nr1a1, Thra1, Thra2, T3R[a], AW259572, T3Ralpha, c-erbA-1, c-erbAalpha, c-erbA-alpha, 6430529J03Rik

UniProt

P63058

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001300912.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NSARSPDGKRKRKNGQCPLKSSMSGYIPSYLDKDEQCVVCGDKATGYHYR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Chloro-N-[2-(diethylamino)ethyl]-4-quinolinecarboxamide
TRC-C365260-500MG 500 mg

2-Chloro-N-[2-(diethylamino)ethyl]-4-quinolinecarboxamide

Sign In for Pricing
View Details
Human ThyroglobULin (TG) activation kit by CRISPRa
GA104845 1 Kit

Human ThyroglobULin (TG) activation kit by CRISPRa

Sign In for Pricing
View Details
2-Deoxy-2,2-difluoro-4,5-O-isopropylidene-D-threo-pentonic Acid Ethyl Ester
TRC-D232830-2.5G 2.5 g

2-Deoxy-2,2-difluoro-4,5-O-isopropylidene-D-threo-pentonic Acid Ethyl Ester

Sign In for Pricing
View Details
Catenin, beta (CTNNB1) (rCTNNB1/2173), CF647 conjugate, 0.1mg/mL
BNC472173-500 1x 500 µL

Catenin, beta (CTNNB1) (rCTNNB1/2173), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
OptiWell™ Sealing Mats for DW Plates
D3320-21 50 Units/Pack

OptiWell™ Sealing Mats for DW Plates

Sign In for Pricing
View Details
Tissue FFPE Sections, Esophagus
CS713882 5x 5 µm

Tissue FFPE Sections, Esophagus

Sign In for Pricing
View Details