Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SERPINA7 Peptide - middle region

SERPINA7 Peptide - middle region

Product Specifications

Product Name Alternative

Tbg, C730040N12Rik

UniProt

P61939

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

XP_006528641.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PKNELELQMGNAVFIGQQLKPLAKFLDDVKTLYETEVFSTDFSNVSAAQH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Atp6v1g2 shRNA (UAS) - Lentiviral mouse Atp6v1g2 shRNA (UAS, RFP) plasmid
GTR15168637 1 Vial

Lentiviral mouse Atp6v1g2 shRNA (UAS) - Lentiviral mouse Atp6v1g2 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Phospho-Jak1 (Tyr1034/1035) Antibody
CST 3331S 100 µL

Phospho-Jak1 (Tyr1034/1035) Antibody

Sign In for Pricing
View Details
Anti- Human HER3 / ErbB3
IT-300-005M2-01 0.1 mg

Anti- Human HER3 / ErbB3

Sign In for Pricing
View Details
Anti- Human HER3 / ErbB3
IT-300-005M2-02 0.5 mg

Anti- Human HER3 / ErbB3

Sign In for Pricing
View Details
SM-164
C12431-5mg 5 mg

SM-164

Sign In for Pricing
View Details
Rac GAP1 shRNA (m) Lentiviral Particles
sc-76336-V 200 µL

Rac GAP1 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details