What is the catalog number for SERPINA7 Peptide - middle region?

The catalog number for SERPINA7 Peptide - middle region is orb1997517.

What sizes are available for SERPINA7 Peptide - middle region?

SERPINA7 Peptide - middle region is available in the following size(s): 100 µg.

Is SERPINA7 Peptide - middle region in stock?

SERPINA7 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

SERPINA7 Peptide - middle region

Product Specifications

Product Name Alternative

Tbg, C730040N12Rik

UniProt

P61939

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

XP_006528641.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PKNELELQMGNAVFIGQQLKPLAKFLDDVKTLYETEVFSTDFSNVSAAQH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NBP2-79893AF488 0.1 mL

Mouse Monoclonal TMEPAI Antibody (PMEPA1/2698) [Alexa Fluor 488]

Sign In for Pricing

View Details

orb3004220-01 20 µg

Recombinant Human Zinc finger protein 723 (ZN723)

Sign In for Pricing

View Details

orb3004220-02 100 µg

Recombinant Human Zinc finger protein 723 (ZN723)

Sign In for Pricing

View Details

orb3004220-03 1 mg

Recombinant Human Zinc finger protein 723 (ZN723)

Sign In for Pricing

View Details

K2176102 1.0 µg DNA

SLC25A5P2 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing

View Details

NBP3-26976IR 0.1 mL

Mouse Monoclonal NM23-H2/NME2 Antibody (NME2/4160) [DyLight 755]

Sign In for Pricing

View Details