Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRDX2 Peptide - C-terminal region

PRDX2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

TR, PRP, TPx, TSA, TDX1, NkefB, PrxII, TPx-B, Tdpx1, Torin, Band-8, AL022839

UniProt

Q61171

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001304314.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-Nitrosotris-(2-chloroethyl)urea 90%
TRC-N547250-25MG 25 mg

N-Nitrosotris-(2-chloroethyl)urea 90%

Sign In for Pricing
View Details
HMGN3 Human Gene Knockout Kit (CRISPR)
KN402339 1 Kit

HMGN3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Usp45 Mouse Gene Knockout Kit (CRISPR)
KN518803 1 Kit

Usp45 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD20 / MS4A1 (B-Cell Marker) (MS4A1/3410), CF647 conjugate, 0.1mg/mL
BNC473410-100 1x 100 µL

CD20 / MS4A1 (B-Cell Marker) (MS4A1/3410), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Blocks, Lung
CB526217 1 Block

Frozen Tissue Blocks, Lung

Sign In for Pricing
View Details
CLIC2 (NM_001289) Human Over-expression Lysate
LC420025 20 µg

CLIC2 (NM_001289) Human Over-expression Lysate

Sign In for Pricing
View Details