Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DDX6 Peptide - N-terminal region

DDX6 Peptide - N-terminal region

Product Specifications

Product Name Alternative

P54, rck, HLR2, mRCK/P54, 1110001P04Rik, E230023J21Rik

UniProt

P54823

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001104296.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GTQPQPQLNQLKNTSTINNGTPQQAQSMAATIKPGDDWKKTLKLPPKDLR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Prostate
CS707999 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Melanoma gp100 (PMEL) Mouse Monoclonal Antibody [Clone ID: SPM142]
AM50168PU-S 100 µg

Melanoma gp100 (PMEL) Mouse Monoclonal Antibody [Clone ID: SPM142]

Sign In for Pricing
View Details
Protein Kinase D2 (PRKD2) (NM_001079880) Human Over-expression Lysate
LC421574 20 µg

Protein Kinase D2 (PRKD2) (NM_001079880) Human Over-expression Lysate

Sign In for Pricing
View Details
Elastin (ELN) (Marker of Arterial Stiffness and Atherosclerosis) (ELN/1981), CF640R conjugate, 0.1mg/mL
BNC401981-100 1x 100 µL

Elastin (ELN) (Marker of Arterial Stiffness and Atherosclerosis) (ELN/1981), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Aconitase 1 (ACO1) ELISA Kit
RDR-ACO1-Hu-01 96 Tests

Human Aconitase 1 (ACO1) ELISA Kit

Sign In for Pricing
View Details
Human Aconitase 1 (ACO1) ELISA Kit
RDR-ACO1-Hu-02 48 Tests

Human Aconitase 1 (ACO1) ELISA Kit

Sign In for Pricing
View Details