Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DDX6 Peptide - N-terminal region

DDX6 Peptide - N-terminal region

Product Specifications

Product Name Alternative

P54, rck, HLR2, mRCK/P54, 1110001P04Rik, E230023J21Rik

UniProt

P54823

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001104296.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GTQPQPQLNQLKNTSTINNGTPQQAQSMAATIKPGDDWKKTLKLPPKDLR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSMC5 Rabbit Polyclonal Antibody
TA380459 100 µL

PSMC5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human FGF-19/FGF19 Protein (His Tag)
PKSH032436-01 20 µg

Recombinant Human FGF-19/FGF19 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human FGF-19/FGF19 Protein (His Tag)
PKSH032436-02 100 µg

Recombinant Human FGF-19/FGF19 Protein (His Tag)

Sign In for Pricing
View Details
Ambra1 Mouse Gene Knockout Kit (CRISPR)
KN501181 1 Kit

Ambra1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human LH (Luteinizing Hormone) ELISA Kit
E-EL-H6019-01 24 Tests

Human LH (Luteinizing Hormone) ELISA Kit

Sign In for Pricing
View Details
Human LH (Luteinizing Hormone) ELISA Kit
E-EL-H6019-02 48 Tests

Human LH (Luteinizing Hormone) ELISA Kit

Sign In for Pricing
View Details