Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC22A3 Peptide - middle region

SLC22A3 Peptide - middle region

Product Specifications

Product Name Alternative

EMT, Oct3, Orct3, Slca22a3

UniProt

Q9WTW5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_035525.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LQILRRVAKCNGKHLSSNYSEITVTDEEVSNPSCLDLVRTPQMRKCTLIL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat rno-miR-92a-3p miRNA Agomir
abx884577-01 5 nmol

Rat rno-miR-92a-3p miRNA Agomir

Sign In for Pricing
View Details
Rat rno-miR-92a-3p miRNA Agomir
abx884577-02 10 nmol

Rat rno-miR-92a-3p miRNA Agomir

Sign In for Pricing
View Details
Nucleolysin TIA-1 isoform p40 TIA1/TIA Rabbit Polyclonal Antibody (Biotin)
orb2574801 100 µg

Nucleolysin TIA-1 isoform p40 TIA1/TIA Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Phospho-B23 (T199) Polyclonal Antibody
BT-PHS00902-01 20 µL

Phospho-B23 (T199) Polyclonal Antibody

Sign In for Pricing
View Details
Phospho-B23 (T199) Polyclonal Antibody
BT-PHS00902-02 50 µL

Phospho-B23 (T199) Polyclonal Antibody

Sign In for Pricing
View Details
Phospho-B23 (T199) Polyclonal Antibody
BT-PHS00902-03 100 µL

Phospho-B23 (T199) Polyclonal Antibody

Sign In for Pricing
View Details