Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC22A3 Peptide - middle region

SLC22A3 Peptide - middle region

Product Specifications

Product Name Alternative

EMT, Oct3, Orct3, Slca22a3

UniProt

Q9WTW5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_035525.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LQILRRVAKCNGKHLSSNYSEITVTDEEVSNPSCLDLVRTPQMRKCTLIL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal CCDC65 Antibody
NBP2-84617-0.1mL 0.1 mL

Rabbit Polyclonal CCDC65 Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human AR Polyclonal Antibody
PA89485HU-01 50 µg

Rabbit Anti-Human AR Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human AR Polyclonal Antibody
PA89485HU-02 100 µg

Rabbit Anti-Human AR Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human AR Polyclonal Antibody
PA89485HU-03 500 µg

Rabbit Anti-Human AR Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human AR Polyclonal Antibody
PA89485HU-04 1 mg

Rabbit Anti-Human AR Polyclonal Antibody

Sign In for Pricing
View Details
Rat Cnx (Calnexin) ELISA Kit
FY-ER1981 96 Well

Rat Cnx (Calnexin) ELISA Kit

Sign In for Pricing
View Details