Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VPS28 Peptide - middle region

VPS28 Peptide - middle region

Product Specifications

Product Name Alternative

CIIA, 1110014J03Rik, D730005C08Rik

UniProt

Q9D1C8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001292597.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FRQVQGSEISSIDEFCRKFRLDCPLAMERIKEDRPITIKDDKGNLNRCIA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KAT2B Rabbit Polyclonal Antibody
TA377684 100 µL

KAT2B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
WIBG (PYM1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI11C5]
TA806390BM 100 µL

WIBG (PYM1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI11C5]

Sign In for Pricing
View Details
Human LSMD1 (NAA38) activation kit by CRISPRa
GA113510 1 Kit

Human LSMD1 (NAA38) activation kit by CRISPRa

Sign In for Pricing
View Details
LYN Antibody (Biotin)
KB-2775-01 50 μL

LYN Antibody (Biotin)

Sign In for Pricing
View Details
LYN Antibody (Biotin)
KB-2775-02 100 µL

LYN Antibody (Biotin)

Sign In for Pricing
View Details
LYN Antibody (Biotin)
KB-2775-03 1 mL

LYN Antibody (Biotin)

Sign In for Pricing
View Details