Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VPS28 Peptide - middle region

VPS28 Peptide - middle region

Product Specifications

Product Name Alternative

CIIA, 1110014J03Rik, D730005C08Rik

UniProt

Q9D1C8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001292597.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FRQVQGSEISSIDEFCRKFRLDCPLAMERIKEDRPITIKDDKGNLNRCIA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(R)-(+)-a-Lipoic Acid
TRC-L468725-5G 5 g

(R)-(+)-a-Lipoic Acid

Sign In for Pricing
View Details
Human CCL5/RANTES, Tag Free
HA210998-01 Inquire

Human CCL5/RANTES, Tag Free

Sign In for Pricing
View Details
Human CCL5/RANTES, Tag Free
HA210998-02 50 µg

Human CCL5/RANTES, Tag Free

Sign In for Pricing
View Details
Human CCL5/RANTES, Tag Free
HA210998-03 100 µg

Human CCL5/RANTES, Tag Free

Sign In for Pricing
View Details
Cytokeratin 10 (LH2), CF568 conjugate, 0.1mg/mL
BNC680674-100 1x 100 µL

Cytokeratin 10 (LH2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BRCA1 (Breast Marker) (BRCA1/1398), CF405S conjugate, 0.1mg/mL
BNC041398-500 1x 500 µL

BRCA1 (Breast Marker) (BRCA1/1398), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details