ALDH3A2 Peptide - middle region
ALDH3A2 Peptide - middle region
Product Specifications
Product Name Alternative
Ahd3, Ahd-3, Aldh4, FALDH, Ahd-3r, Ahd3-r, Aldh4-r, AI194803
UniProt
P47740
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_031463.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ASPDYERIINLRHFKRLQSLLKGQKIAFGGEMDEATRYLAPTILTDVDPN
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC043813-500 1x 500 µL
TPO (Thyroid Peroxidase) (Thyroid Marker) (TPO/3813R), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![2,2'-((4-(4',5'-Bis(1,3,2-dithiarsolan-2-yl)-3',6'-dihydroxy-3-oxo-3H-spiro[isobenzofuran-1,9'-xanthen]-5-ylcarboxamido)-2-(2-morpholino-2-oxoethoxy)phenyl)azanediyl)diacetic Acid](https://cdn.genprice.uk/products/572/12050955/imageurl/trc-b431940-50mg.webp)
TRC-B431940-50MG 50 mg
2,2'-((4-(4',5'-Bis(1,3,2-dithiarsolan-2-yl)-3',6'-dihydroxy-3-oxo-3H-spiro[isobenzofuran-1,9'-xanthen]-5-ylcarboxamido)-2-(2-morpholino-2-oxoethoxy)phenyl)azanediyl)diacetic Acid
Sign In for Pricing
View Details 
BNCB2215-100 1x 100 µL
Tyrosinase (Melanoma Marker) (rOCA1/812), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
