Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALDH3A2 Peptide - middle region

ALDH3A2 Peptide - middle region

Product Specifications

Product Name Alternative

Ahd3, Ahd-3, Aldh4, FALDH, Ahd-3r, Ahd3-r, Aldh4-r, AI194803

UniProt

P47740

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_031463.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ASPDYERIINLRHFKRLQSLLKGQKIAFGGEMDEATRYLAPTILTDVDPN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

YBX1 / Y-box Binding Protein 1 / YB-1 (Tumor Biomarker) (YBX1/2430), CF568 conjugate, 0.1mg/mL
BNC682430-500 1x 500 µL

YBX1 / Y-box Binding Protein 1 / YB-1 (Tumor Biomarker) (YBX1/2430), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SOX14 Human Gene Knockout Kit (CRISPR)
KN422052 1 Kit

SOX14 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FAM178B (NM_001122646) Human Over-expression Lysate
LC426541 20 µg

FAM178B (NM_001122646) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Mouse KIRREL3/NEPH2 Protein (His Tag)
PKSM040725 100 µg

Recombinant Mouse KIRREL3/NEPH2 Protein (His Tag)

Sign In for Pricing
View Details
Uroplakin 1B (Urothelial Differentiation Marker) (UPK1B/3081), CF488A conjugate, 0.1mg/mL
BNC883081-500 1x 500 µL

Uroplakin 1B (Urothelial Differentiation Marker) (UPK1B/3081), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Perforin-1 (Pore Forming Protein) (Apoptosis Marker) (PRF1/2470), CF594 conjugate, 0.1mg/mL
BNC942470-100 1x 100 µL

Perforin-1 (Pore Forming Protein) (Apoptosis Marker) (PRF1/2470), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details