PURB Peptide - C-terminal region
PURB Peptide - C-terminal region
Product Specifications
Product Name Alternative
Cager-2, AA114818, D11Bwg0414e, 2310015K15Rik
UniProt
O35295
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_035351.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: TVPFKAWGKFGGAFCRYADEMKEIQERQRDKLYERRGGGSGGGDESEGEE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15259634 1 Vial
Lentiviral mouse Cacng6 shRNA (UAS) - Lentiviral mouse Cacng6 shRNA (UAS, iRFP) (25)
Sign In for Pricing
View Details 
MBS6438610-01 0.1 mL
SP1, Phosphorylated (T739) (TSFP1, Sp1 Transcription Factor) (FITC)
Sign In for Pricing
View Details MBS6438610-02 5x 0.1 mL
SP1, Phosphorylated (T739) (TSFP1, Sp1 Transcription Factor) (FITC)
Sign In for Pricing
View Details 