PURB Peptide - C-terminal region
PURB Peptide - C-terminal region
Product Specifications
Product Name Alternative
Cager-2, AA114818, D11Bwg0414e, 2310015K15Rik
UniProt
O35295
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_035351.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: TVPFKAWGKFGGAFCRYADEMKEIQERQRDKLYERRGGGSGGGDESEGEE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
M00125-1-carrier-free 100 µL
Anti-PCNA Rabbit Monoclonal Antibody, Carrier-free
Sign In for Pricing
View Details 
QS2415Hu-01 48 Tests
Quick Step Human Superoxide Dismutase 2 (SOD-2) elisa Kit
Sign In for Pricing
View Details QS2415Hu-02 96 Tests
Quick Step Human Superoxide Dismutase 2 (SOD-2) elisa Kit
Sign In for Pricing
View Details 66863121 3x 1.0µg DNA
RHOQP CRISPRa sgRNA lentivector (set of three targets)(Human)
Sign In for Pricing
View Details 