RPL6 Peptide - middle region
RPL6 Peptide - middle region
Product Specifications
Product Name Alternative
Taxreb107
UniProt
P47911
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_035420.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KVEKKKKKEKVLATVTKTVGGDKNGGTRVVKLRKMPRYYPTEDVPRKLLS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
sc-407126-LAC-2 200 µL
Triadin Lentiviral Activation Particles (h2)
Sign In for Pricing
View Details orb3053806-01 20 µg
Recombinant Candida albicans chitin deacetylase (CDA2)
Sign In for Pricing
View Details orb3053806-02 100 µg
Recombinant Candida albicans chitin deacetylase (CDA2)
Sign In for Pricing
View Details orb3053806-03 1 mg
Recombinant Candida albicans chitin deacetylase (CDA2)
Sign In for Pricing
View Details 
GTR15163995 1 Vial
Lentiviral mouse Vmn1r43 shRNA (UAS) - Lentiviral mouse Vmn1r43 shRNA (UAS, iRFP) (100)
Sign In for Pricing
View Details