RPL6 Peptide - middle region
RPL6 Peptide - middle region
Product Specifications
Product Name Alternative
Taxreb107
UniProt
P47911
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_035420.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KVEKKKKKEKVLATVTKTVGGDKNGGTRVVKLRKMPRYYPTEDVPRKLLS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6167798-01 0.1 mL
ATOH1 (Atonal Homolog 1 (Drosophila), ATH1, HATH1, MATH-1, bHLHa14) (APC)
Sign In for Pricing
View Details MBS6167798-02 5x 0.1 mL
ATOH1 (Atonal Homolog 1 (Drosophila), ATH1, HATH1, MATH-1, bHLHa14) (APC)
Sign In for Pricing
View Details NBP2-90194MFV610 0.1 mL
Rabbit Monoclonal UBE2D4/Ubch5d Antibody (129) [mFluor Violet 610 SE]
Sign In for Pricing
View Details 
S1040-06F-HRP 100 µL
SOCS6 (Suppressor of Cytokine Signaling 6, SOCS-6, Cytokine-inducible SH2 Protein 4, CIS-4, Suppressor of Cytokine Signaling 4, SOCS-4, CIS4, SOCS4) (HRP)
Sign In for Pricing
View Details