SLC45A3 Peptide - middle region
SLC45A3 Peptide - middle region
Product Specifications
Product Name Alternative
PRST, IPCA-6, Pcanap6, AU023994, AU043764, 2210413P12Rik
UniProt
Q8K0H7
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001171099.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ALMTFTLFYTDFVGEGLYQGVPRAEPGTEARRHYDEGIRMGSLGLFLQCA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15370483 1 Vial
Lentiviral human LIPG sgRNA gene knockout kit - Lentiviral human LIPG sgRNA gene knockout kit (100)
Sign In for Pricing
View Details 
KTE100466-01 48 Tests
ELISA kit for Rat 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase zeta-1 (PLCZ1)
Sign In for Pricing
View Details KTE100466-02 96 Tests
ELISA kit for Rat 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase zeta-1 (PLCZ1)
Sign In for Pricing
View Details KTE100466-03 5x 96 Well
ELISA kit for Rat 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase zeta-1 (PLCZ1)
Sign In for Pricing
View Details 
MBS6407449-01 0.1 mL
ATF2, Phosphorylated (T71/T53) (Activating Transcription Factor 2, HB16, CREB2, TREB7, CRE-BP1) (MaxLight 405)
Sign In for Pricing
View Details MBS6407449-02 5x 0.1 mL
ATF2, Phosphorylated (T71/T53) (Activating Transcription Factor 2, HB16, CREB2, TREB7, CRE-BP1) (MaxLight 405)
Sign In for Pricing
View Details