What is the catalog number for SLC45A3 Peptide - middle region?

The catalog number for SLC45A3 Peptide - middle region is orb1997503.

What sizes are available for SLC45A3 Peptide - middle region?

SLC45A3 Peptide - middle region is available in the following size(s): 100 µg.

Is SLC45A3 Peptide - middle region in stock?

SLC45A3 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

SLC45A3 Peptide - middle region

Product Specifications

Product Name Alternative

PRST, IPCA-6, Pcanap6, AU023994, AU043764, 2210413P12Rik

UniProt

Q8K0H7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001171099.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ALMTFTLFYTDFVGEGLYQGVPRAEPGTEARRHYDEGIRMGSLGLFLQCA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PV281189 500 ng

March7 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing

View Details

TU102563 1.0 mL

BC013529 3'UTR Luciferase Stable Cell Line

Sign In for Pricing

View Details

TP311399L 1 mg

LRP5L (NM_182492) Human Recombinant Protein

Sign In for Pricing

View Details

K0888908 1.0 µg DNA

GPR3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing

View Details

orb995638 100 µL

Apolipoprotein D Rabbit Polyclonal Antibody (APC)

Sign In for Pricing

View Details

NBP2-54597-20ug 20 µg

Mouse Monoclonal Perilipin-2/ADFP Antibody (ADFP/1494)

Sign In for Pricing

View Details