Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GSTM5 Peptide - middle region

GSTM5 Peptide - middle region

Product Specifications

UniProt

P48774

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_034490.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ITQSNAILRYIARKHNMCGDTEEEKIRVDIMENQIMDFRMQLVRLCYNSN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELAV1 Polyclonal Antibody
BT-AP08799-01 20 µL

ELAV1 Polyclonal Antibody

Sign In for Pricing
View Details
ELAV1 Polyclonal Antibody
BT-AP08799-02 50 µL

ELAV1 Polyclonal Antibody

Sign In for Pricing
View Details
ELAV1 Polyclonal Antibody
BT-AP08799-03 100 µL

ELAV1 Polyclonal Antibody

Sign In for Pricing
View Details
DSPE-PEG-Antinucleosome mAb 2C5
MPL0761K Each

DSPE-PEG-Antinucleosome mAb 2C5

Sign In for Pricing
View Details
SLC43A3 Human qPCR Template Standard (NM_014096)
HK206841 1 Kit

SLC43A3 Human qPCR Template Standard (NM_014096)

Sign In for Pricing
View Details
SEMA3A Protein Vector (Mouse) (pPB-C-His)
PV227566 500 ng

SEMA3A Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details