Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GSTM5 Peptide - middle region

GSTM5 Peptide - middle region

Product Specifications

UniProt

P48774

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_034490.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ITQSNAILRYIARKHNMCGDTEEEKIRVDIMENQIMDFRMQLVRLCYNSN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat Neonatal Thyroxine (NN-T4) ELISA Kit
NSL0121Gt 96 Tests

Goat Neonatal Thyroxine (NN-T4) ELISA Kit

Sign In for Pricing
View Details
Mangiferin
90028753 1 g

Mangiferin

Sign In for Pricing
View Details
Recombinant Campylobacter Jejuni dapA Protein (aa 1-298) (strain 81116 / NCTC 11828)
VAng-Ly2088-1mgEcoli 1 mg (E. coli)

Recombinant Campylobacter Jejuni dapA Protein (aa 1-298) (strain 81116 / NCTC 11828)

Sign In for Pricing
View Details
CCR7 (NM_001301716) Human Tagged ORF Clone
RC237805 10 µg

CCR7 (NM_001301716) Human Tagged ORF Clone

Sign In for Pricing
View Details
Vortioxetine Impurity 60
CS-O-54001 1 Each

Vortioxetine Impurity 60

Sign In for Pricing
View Details
LOC680045 sgRNA CRISPR Lentivector (Rat) (Target 2)
K6443503 1.0 µg DNA

LOC680045 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details