Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

INSM1 Peptide - middle region

INSM1 Peptide - middle region

Product Specifications

Product Name Alternative

IA-1

UniProt

Q63ZV0

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_058585.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EAAGGGSSDRDTPSPGGVSESGSEDGLYECHHCAKKFRRQAYLRKHLLAH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GCOM1 (POLR2M) (NM_015532) Human Recombinant Protein
TP319621 20 µg

GCOM1 (POLR2M) (NM_015532) Human Recombinant Protein

Sign In for Pricing
View Details
Carbonic anhydrase X (CA10) (NM_020178) Human Recombinant Protein
TP313425L 1 mg

Carbonic anhydrase X (CA10) (NM_020178) Human Recombinant Protein

Sign In for Pricing
View Details
CD98 Mouse Monoclonal Antibody [A9D8]
HA601124 100 µL

CD98 Mouse Monoclonal Antibody [A9D8]

Sign In for Pricing
View Details
Recombinant Human LGALS7 Protein (Sumo Tag)
PDEH100556-01 20 µg

Recombinant Human LGALS7 Protein (Sumo Tag)

Sign In for Pricing
View Details
Recombinant Human LGALS7 Protein (Sumo Tag)
PDEH100556-02 100 µg

Recombinant Human LGALS7 Protein (Sumo Tag)

Sign In for Pricing
View Details
Recombinant Human LGALS7 Protein (Sumo Tag)
PDEH100556-03 500 µg

Recombinant Human LGALS7 Protein (Sumo Tag)

Sign In for Pricing
View Details