PDIA6 Peptide - middle region
PDIA6 Peptide - middle region
Product Specifications
Product Name Alternative
P5, CaBP5, C77895, Txndc7, AL023058, 1700015E05Rik
UniProt
Q922R8
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_082235.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KIFQKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELLEIINEDIAKKT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
PKSH032162-01 10 µg
Recombinant Human Carbonic Anhydrase 4/CA4 Protein (His Tag)
Sign In for Pricing
View Details PKSH032162-02 50 µg
Recombinant Human Carbonic Anhydrase 4/CA4 Protein (His Tag)
Sign In for Pricing
View Details 
MP3831 100 µL
Anti-Myosin IIA Heavy Chain (Ser-1943), Phosphospecific Antibody
Sign In for Pricing
View Details 
