PDIA6 Peptide - middle region
PDIA6 Peptide - middle region
Product Specifications
Product Name Alternative
P5, CaBP5, C77895, Txndc7, AL023058, 1700015E05Rik
UniProt
Q922R8
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_082235.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KIFQKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELLEIINEDIAKKT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC472167-500 1x 500 µL
Emerin (Papillary Thyroid Carcinoma and EDMD Marker) (EMD/2167), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
TRV-0023307-01 200 µL
FITC-Linked Polyclonal Antibody to Elastin (ELN)
Sign In for Pricing
View Details