Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MSL3 Peptide - middle region

MSL3 Peptide - middle region

Product Specifications

Product Name Alternative

Msl31, Msl3l1, AU018931

UniProt

Q9WVG9

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_034962.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VFAGFEGRRPNEINEVLSWKLVPDNYPPGDQPPPPSYIYGAQHLLRLFVK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Cd8a/T-cell surface glycoprotein CD8 alpha chain ELISA Kit
orb1662040 96 Tests

Rat Cd8a/T-cell surface glycoprotein CD8 alpha chain ELISA Kit

Sign In for Pricing
View Details
Human OR5M8 Knockout A549 cell line
GTR15421762 1 Vial

Human OR5M8 Knockout A549 cell line

Sign In for Pricing
View Details
Anti-C6orf58 Polyclonal Antibody
TMAB-03480-01 50 μL

Anti-C6orf58 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-C6orf58 Polyclonal Antibody
TMAB-03480-02 100 µL

Anti-C6orf58 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-C6orf58 Polyclonal Antibody
TMAB-03480-03 200 µL

Anti-C6orf58 Polyclonal Antibody

Sign In for Pricing
View Details
AKT3 (v-akt murine Thymoma Viral Oncogene Homolog 3 (Protein Kinase B, gamma), DKFZp434N0250, PKB-GAMMA, PKBG, PRKBG, RAC-PK-gamma, RAC-gamma, STK-2) (MaxLight 550)
243231-ML550 100 µL

AKT3 (v-akt murine Thymoma Viral Oncogene Homolog 3 (Protein Kinase B, gamma), DKFZp434N0250, PKB-GAMMA, PKBG, PRKBG, RAC-PK-gamma, RAC-gamma, STK-2) (MaxLight 550)

Sign In for Pricing
View Details