HTR2B Peptide - C-terminal region
HTR2B Peptide - C-terminal region
Product Specifications
Product Name Alternative
5-HT2B, AJ012488, AV377389
UniProt
Q02152
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_032337.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KHGIRNGINPAMYQSPMRLRSSTIQSSSIILLDTLLTENDGDKAEEQVSY
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
K2686706 1.0 µg DNA
ZNF101 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
Sign In for Pricing
View Details orb3163737 100 µL
Cytokeratin 19 Recombinant Rabbit mAb, RBITC conjugated
Sign In for Pricing
View Details 
ARP41868_P050 100 µL
CYB561 antibody - middle region (ARP41868_P050)
Sign In for Pricing
View Details