HTR2B Peptide - C-terminal region
HTR2B Peptide - C-terminal region
Product Specifications
Product Name Alternative
5-HT2B, AJ012488, AV377389
UniProt
Q02152
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_032337.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KHGIRNGINPAMYQSPMRLRSSTIQSSSIILLDTLLTENDGDKAEEQVSY
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
orb3106666 100 µg
SLAM/CD150/SLAMF1 Rabbit Polyclonal Antibody (Fluoro594)
Sign In for Pricing
View Details 
MBS9928374-01 48 Well
Mouse GTP-Binding Protein Rhes (RASD2) ELISA Kit
Sign In for Pricing
View Details MBS9928374-02 96 Well
Mouse GTP-Binding Protein Rhes (RASD2) ELISA Kit
Sign In for Pricing
View Details MBS9928374-03 5x 96 Well
Mouse GTP-Binding Protein Rhes (RASD2) ELISA Kit
Sign In for Pricing
View Details