Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBE2S Peptide - C-terminal region

UBE2S Peptide - C-terminal region

Product Specifications

Product Name Alternative

E2-EPF, AA409170, 0910001J09Rik, 6720465F12Rik

UniProt

Q921J4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_598538.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GRAEATQDLASGASASSADPMIPGVLGGAEGPMAKKHAGERDKKLAAKKK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Colloidal Gold Conjugated Phaseolus lunatus Lectin (Lima Bean) -LBA-,  15nm
GP-1701-15 1 mL

Colloidal Gold Conjugated Phaseolus lunatus Lectin (Lima Bean) -LBA-, 15nm

Sign In for Pricing
View Details
Aurora B (Proliferation Marker) (AURKB/1593), CF740 conjugate, 0.1mg/mL
BNC741593-100 1x 100 µL

Aurora B (Proliferation Marker) (AURKB/1593), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
N,N'-Bis(salicylidene)ethylenediamine
TRC-B585315-25G 25 g

N,N'-Bis(salicylidene)ethylenediamine

Sign In for Pricing
View Details
Chlorophyll a (Technical Grade)
TRC-C379880-1MG 1 mg

Chlorophyll a (Technical Grade)

Sign In for Pricing
View Details
CD66 (CEA) (COL-1), CF647 conjugate, 0.1mg/mL
BNC470002-100 1x 100 µL

CD66 (CEA) (COL-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Mouse ANGPTL3 Protein (Fc Tag)
PDMM100045-01 20 µg

Recombinant Mouse ANGPTL3 Protein (Fc Tag)

Sign In for Pricing
View Details