Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBE2S Peptide - C-terminal region

UBE2S Peptide - C-terminal region

Product Specifications

Product Name Alternative

E2-EPF, AA409170, 0910001J09Rik, 6720465F12Rik

UniProt

Q921J4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_598538.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GRAEATQDLASGASASSADPMIPGVLGGAEGPMAKKHAGERDKKLAAKKK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

c-Fos Recombinant Rabbit Monoclonal Antibody [PSH05-77]
HA722666 100 µL

c-Fos Recombinant Rabbit Monoclonal Antibody [PSH05-77]

Sign In for Pricing
View Details
2-(3-(1H-Indazol-5-yl)ureido)-5-(tert-butyl)thiophene-3-carboxylic Acid
TRC-H117335-50MG 50 mg

2-(3-(1H-Indazol-5-yl)ureido)-5-(tert-butyl)thiophene-3-carboxylic Acid

Sign In for Pricing
View Details
VPS53 (N-term) Rabbit Polyclonal Antibody
AP18239PU-N 400 µL

VPS53 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
VRK1 Mouse Monoclonal Antibody [Clone ID: OTI2C9]
CF805595 100 µg

VRK1 Mouse Monoclonal Antibody [Clone ID: OTI2C9]

Sign In for Pricing
View Details
SPHK1 Human qPCR Primer Pair (NM_182965)
HP233366 200 Reactions

SPHK1 Human qPCR Primer Pair (NM_182965)

Sign In for Pricing
View Details
TCF4 (Transcription Factor 4) (TCF4/1705), CF488A conjugate, 0.1mg/mL
BNC881705-100 1x 100 µL

TCF4 (Transcription Factor 4) (TCF4/1705), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details