Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APOBEC2 Peptide - middle region

APOBEC2 Peptide - middle region

Product Specifications

Product Name Alternative

Arp1

UniProt

Q9WV35

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_033824.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LPVNFFKFQFRNVEYSSGRNKTFLCYVVEVQSKGGQAQATQGYLEDEHAG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Receptor-type tyrosine-protein Phosphatase S (PTPRS) Rat ELISA Kit
G6913 96 Tests

Receptor-type tyrosine-protein Phosphatase S (PTPRS) Rat ELISA Kit

Sign In for Pricing
View Details
NUDT2 Antibody - middle region (ARP86174_P050)
ARP86174_P050 100 µL

NUDT2 Antibody - middle region (ARP86174_P050)

Sign In for Pricing
View Details
Mucin-1 Mouse Monoclonal Antibody (BF750)
orb2364332 100 µL

Mucin-1 Mouse Monoclonal Antibody (BF750)

Sign In for Pricing
View Details
PerCP/Cyanine5.5 anti-mouse IL-2
GT18292 25 µg

PerCP/Cyanine5.5 anti-mouse IL-2

Sign In for Pricing
View Details
Car8 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
15029116 3x 1.0 µg

Car8 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Fut9 3'UTR Luciferase Stable Cell Line
TU106790 1.0 mL

Fut9 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details