What is the catalog number for APOBEC2 Peptide - middle region?

The catalog number for APOBEC2 Peptide - middle region is orb1997492.

What sizes are available for APOBEC2 Peptide - middle region?

APOBEC2 Peptide - middle region is available in the following size(s): 100 µg.

Is APOBEC2 Peptide - middle region in stock?

APOBEC2 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

APOBEC2 Peptide - middle region

Product Specifications

Product Name Alternative

Arp1

UniProt

Q9WV35

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_033824.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LPVNFFKFQFRNVEYSSGRNKTFLCYVVEVQSKGGQAQATQGYLEDEHAG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AP91011 50 µg

Recombinant Human CD119/IFNGR1 Protein, C-His

Sign In for Pricing

View Details

MAB4374-SP 25 µg

Mouse C1qTNF10/C1qL2 MAb (Clone 384921)

Sign In for Pricing

View Details

S4562-500mg 500 mg

Dehydrocholic acid

Sign In for Pricing

View Details

sc-123879 100 µg - 200 µL

Syntaxin 3 (m) : 293T Lysate

Sign In for Pricing

View Details

MBS072816-01 48 Well

Camel Acetyl Coenzyme A Acetyltransferase 1 ELISA Kit

Sign In for Pricing

View Details

MBS072816-02 96 Well

Camel Acetyl Coenzyme A Acetyltransferase 1 ELISA Kit

Sign In for Pricing

View Details