Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TLR4 Peptide - middle region

TLR4 Peptide - middle region

Product Specifications

Product Name Alternative

TOLL, CD284, TLR-4, ARMD10

UniProt

O00206

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_003257.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RLHKLTLRNNFDSLNVMKTCIQGLAGLEVHRLVLGEFRNEGNLEKFDKSA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

6H05 (TFA)
orb1299917-01 1 mg

6H05 (TFA)

Sign In for Pricing
View Details
6H05 (TFA)
orb1299917-02 2 mg

6H05 (TFA)

Sign In for Pricing
View Details
6H05 (TFA)
orb1299917-03 5 mg

6H05 (TFA)

Sign In for Pricing
View Details
6H05 (TFA)
orb1299917-04 1 ml x 10 mM (in DMSO)

6H05 (TFA)

Sign In for Pricing
View Details
6H05 (TFA)
orb1299917-05 10 mg

6H05 (TFA)

Sign In for Pricing
View Details
6H05 (TFA)
orb1299917-06 25 mg

6H05 (TFA)

Sign In for Pricing
View Details