Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TLR4 Peptide - middle region

TLR4 Peptide - middle region

Product Specifications

Product Name Alternative

TOLL, CD284, TLR-4, ARMD10

UniProt

O00206

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_003257.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RLHKLTLRNNFDSLNVMKTCIQGLAGLEVHRLVLGEFRNEGNLEKFDKSA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Haptoglobin Related Protein (HPR) ELISA Kit
YP-W200542-01 48 Tests

Bovine Haptoglobin Related Protein (HPR) ELISA Kit

Sign In for Pricing
View Details
Bovine Haptoglobin Related Protein (HPR) ELISA Kit
YP-W200542-02 96 Tests

Bovine Haptoglobin Related Protein (HPR) ELISA Kit

Sign In for Pricing
View Details
RAB2A Antibody, HRP conjugated
CSB-PA019180LB01HU-01 50 µg

RAB2A Antibody, HRP conjugated

Sign In for Pricing
View Details
RAB2A Antibody, HRP conjugated
CSB-PA019180LB01HU-02 100 µg

RAB2A Antibody, HRP conjugated

Sign In for Pricing
View Details
TCEB1 Rabbit pAb (APR24525N)
APR24525N-01 50 µL

TCEB1 Rabbit pAb (APR24525N)

Sign In for Pricing
View Details
TCEB1 Rabbit pAb (APR24525N)
APR24525N-02 100 µL

TCEB1 Rabbit pAb (APR24525N)

Sign In for Pricing
View Details