Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DDX10 Peptide - C-terminal region

DDX10 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HRH-J8

UniProt

Q13206

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DDX10 Rabbit Polyclonal Antibody (orb575931) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_004389

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EANKRQAKAKDEEEAFLDWSDDDDDDDDGFDPSTLPDPDKYRSSEDSDSE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GOT2 Rabbit Polyclonal Antibody
TA350033 100 µL

GOT2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral human TSPAN6 shRNA (UAS) - Lentiviral human TSPAN6 shRNA (UAS, iRFP) (100)
GTR15330342 1 Vial

Lentiviral human TSPAN6 shRNA (UAS) - Lentiviral human TSPAN6 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Rabbit Toll Like Receptor 6 ELISA Kit
MBS7257280-01 48 Well

Rabbit Toll Like Receptor 6 ELISA Kit

Sign In for Pricing
View Details
Rabbit Toll Like Receptor 6 ELISA Kit
MBS7257280-02 96 Well

Rabbit Toll Like Receptor 6 ELISA Kit

Sign In for Pricing
View Details
Rabbit Toll Like Receptor 6 ELISA Kit
MBS7257280-03 5x 96 Well

Rabbit Toll Like Receptor 6 ELISA Kit

Sign In for Pricing
View Details
Rabbit Toll Like Receptor 6 ELISA Kit
MBS7257280-04 10x 96 Well

Rabbit Toll Like Receptor 6 ELISA Kit

Sign In for Pricing
View Details