MYBBP1A Peptide - N-terminal region
MYBBP1A Peptide - N-terminal region
Product Specifications
Product Name Alternative
P160, PAP2, Pol5
UniProt
Q9BQG0
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with MYBBP1A Rabbit Polyclonal Antibody (orb576963) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_055335
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: MESRDPAQPMSPGEATQSGARPADRYGLLKHSREFLDFFWDIAKPEQETR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Choline Acetyltransferase Recombinant Rabbit Monoclonal Antibody [JA67-11]](https://cdn.genprice.uk/products/992/68dd1c8a061270361ea810f8/imageurl/et1704-16.webp)
ET1704-16 100 µL
Choline Acetyltransferase Recombinant Rabbit Monoclonal Antibody [JA67-11]
Sign In for Pricing
View Details 
