DIS3L Peptide - C-terminal region
DIS3L Peptide - C-terminal region
Product Specifications
Product Name Alternative
DIS3L1
UniProt
Q8TF46
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with DIS3L Rabbit Polyclonal Antibody (orb577903) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_588616
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: NNRNQAAQHSQKQSTELFQCMYFKDKDPATEERCISDGVIYSIRTNGVLL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNCB2151-500 1x 500 µL
TACSTD2 / TROP2 (Epithelial Marker) (TACSTD2/2151), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC042065-500 1x 500 µL
IL3RA / CD123 (Acute Myeloid Leukemia Marker) (IL3RA/2065), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
