DIS3L Peptide - C-terminal region
DIS3L Peptide - C-terminal region
Product Specifications
Product Name Alternative
DIS3L1
UniProt
Q8TF46
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with DIS3L Rabbit Polyclonal Antibody (orb577903) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_588616
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: NNRNQAAQHSQKQSTELFQCMYFKDKDPATEERCISDGVIYSIRTNGVLL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LY400527 100 µg
NY-ESO-1 (CTAG1B) (NM_001327) Human Over-expression Lysate
Sign In for Pricing
View Details 
TRC-H456040-5MG 5 mg
L-Histidine Hydrochloride Hydrate (<5% D) (13C6, 97-99%)
Sign In for Pricing
View Details 
LC428990 20 µg
PAS1C1 (LMNTD1) (NM_001145728) Human Over-expression Lysate
Sign In for Pricing
View Details 